CAS Number: 163648-32-6Molecular Weight: 4520.17Salt Form: TFAPurity: >96%Sequence (3-letter): Ser-Thr-Gly-Cys-Arg-Phe-Gly-Thr-Cys-Thr-Met-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Gly-Met-Ala-Pro-Arg-Asn-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2Sequence (1-letter): STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2Storage: -20 °C or below
Adrenomedullin (11-50) is the active C-terminal fragment of rat adrenomedullin. Adrenomedullin is thought to be a vasodilator and is found in high concentrations in the blood. It also stimulates angiogenesis and increases cellular tolerance to hypoxic injury and oxidative stress.
| Categories | Peptides  | 
|---|
| Filter | Neuropeptides & Hormones  | 
|---|